General Information

  • ID:  hor002477
  • Uniprot ID:  A0A6P6RHA0
  • Protein name:  gGRN
  • Gene name:  LOC113119378
  • Organism:  Carassius auratus (Goldfish)
  • Family:  Granulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Carassius (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  VIHCDSSTICPDGTTCCLSPYGVWYCCPFSMGQCCRDGIHCCRHGYHCDSTSTHCLR
  • Length:  57
  • Propeptide:  MVPVLMLLMAALVAADEPMMALSEPAESVSVIHCDSSTICPDGTTCCLSPYGVWYCCPFSMGQCCRDGIHCCRHGYHCDSTSTHCLRGWLRLPSSPKPATKAIQKPQSVSFDQALNWESQTEQVHCDGNVYCPTEQFCCKSATGQWGCCSEMVV
  • Signal peptide:  MVPVLMLLMAALVAA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A6P6RHA0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002477_AF2.pdbhor002477_ESM.pdb

Physical Information

Mass: 732029 Formula: C260H390N78O81S13
Absent amino acids: AEKN Common amino acids: C
pI: 6.94 Basic residues: 8
Polar residues: 31 Hydrophobic residues: 9
Hydrophobicity: -4.74 Boman Index: -8175
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 44.39
Instability Index: 5415.26 Extinction Coefficient cystines: 10720
Absorbance 280nm: 191.43

Literature

  • PubMed ID:  8536941
  • Title:  Somatostatin-, Vasoactive Intestinal Peptide-, and Granulin-Like Peptides Isolated From Intestinal Extracts of Goldfish, Carassius Auratus